PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012749
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BES1
Protein Properties Length: 515aa    MW: 55465.9 Da    PI: 10.2962
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012749genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822207.24.6e-64191591137
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94 
                  gg++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGn++lpk++DnneVlkALc++AGw+ve+DGtty+kgs+p+     +++++g+s++++p+ss 
  DCAR_012749  19 GGGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNFNLPKHCDNNEVLKALCAQAGWTVEPDGTTYPKGSRPPsidiASMDIGGTSNNTTPCSSR 116
                  689************************************************************************9999889**************** PP

       DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasll 137
                    s+ ss+++sp++sy++sp+sssfpsps+l+  +++++ s++
  DCAR_012749 117 RPSPPSSSFPSPIPSYQPSPTSSSFPSPSRLEPHMSSNPFSFM 159
                  *******************************999887664333 PP

2DUF822207.34.2e-642113511137
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94 
                  gg++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGn++lpk++DnneVlkALc++AGw+ve+DGtty+kgs+p+     +++++g+s++++p+ss 
  DCAR_012749 211 GGGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNFNLPKHCDNNEVLKALCAQAGWTVEPDGTTYPKGSRPPsidiASMDIGGTSNNTTPCSSR 308
                  689************************************************************************9999889**************** PP

       DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasll 137
                    s+ ss+++sp++sy++sp+sssfpsps+l+  +++++ s++
  DCAR_012749 309 RPSPPSSSFPSPIPSYQPSPTSSSFPSPSRLEPHMSSNPFSFM 351
                  ********************************99887663333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.7E-6120156IPR008540BES1/BZR1 plant transcription factor, N-terminal
PfamPF056872.2E-61212349IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MMNWEGESPA SSAGGGGGGG GRRKPSWRER ENNRRRERRR RAIAAKIYAG LRAQGNFNLP  60
KHCDNNEVLK ALCAQAGWTV EPDGTTYPKG SRPPSIDIAS MDIGGTSNNT TPCSSRRPSP  120
PSSSFPSPIP SYQPSPTSSS FPSPSRLEPH MSSNPFSFMR YSNPSSLPPL RISNSNKQLC  180
GGLYVKTLLR GKMMNWEGES PASSAGGGGG GGGRRKPSWR ERENNRRRER RRRAIAAKIY  240
AGLRAQGNFN LPKHCDNNEV LKALCAQAGW TVEPDGTTYP KGSRPPSIDI ASMDIGGTSN  300
NTTPCSSRRP SPPSSSFPSP IPSYQPSPTS SSFPSPSRLE PHMSSNPFSF MRYSNPSSLP  360
PLRISNSAPV TPPLSSSATR ISMHNFNWES IAKQSASLSF PFLAVSAPAS PTRGQRIPPP  420
ATIPECDESD SSTVDSGQWM SFKSYAPSGG PTSPTFNLMK PTTENISSQK AVLDKGKGID  480
FEFEREAVKA WEGERIHEVG LDDLELTLGS GGMQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213232RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-124PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-99BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-120A0A068UH77_COFCA; Uncharacterized protein
STRINGSolyc04g079980.2.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-88BES1 family protein